PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01281.30
Common NameJCGZ_13881, LOC105642480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YB
Protein Properties Length: 174aa    MW: 19368.3 Da    PI: 5.3751
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01281.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB176.33e-5532127297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl++yre ege+
  Jcr4S01281.30  32 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHRYREQEGER 127
                    89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5429142IPR009072Histone-fold
SuperFamilySSF471135.24E-4134140IPR009072Histone-fold
PfamPF008087.3E-2837101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-196583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-1984102No hitNo description
PRINTSPR006151.1E-19103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MVDNASNNSD KSYQKYNFGG ASSGSGEDGI IKEQDRLLPI ANVGRIMKQI LPPNAKISKE  60
AKETMQECVS EFISFVTGEA SDKCHKEKRK TVNGDDICWA LATLGFDDYA EPLKRYLHRY  120
REQEGERASN KGSNNEENDD SSNCRGDQPW KSAVPSAAPF QFDASNNSSV SRRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4531122192Transcription factor HapC (Eurofung)
4g92_B7e-4531122192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR2322751e-138KR232275.1 Vernicia fordii nuclear transcription factor Y subunit B-9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082708.11e-129PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822482e-64NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A067K7771e-129A0A067K777_JATCU; Uncharacterized protein
STRINGVIT_07s0104g01640.t011e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-65nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]